PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G103200.1
Common NamePHAVU_010G103200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 335aa    MW: 37117.1 Da    PI: 9.3702
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G103200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1361105147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Phvul.010G103200.1  61 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 105
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1655111IPR009057Homeodomain-like
PROSITE profilePS5129415.40856110IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-659111IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1859108IPR006447Myb domain, plants
SMARTSM007175.3E-1160108IPR001005SANT/Myb domain
PfamPF002492.8E-1161105IPR001005SANT/Myb domain
CDDcd001672.09E-863106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVSVNPNPAQ GFYFFDPSNM TLPGVNSLPP PPPPPQTPAA SVALEDPNKK IRKPYTITKS  60
RESWTEQEHD KFLEALQLFD RDWKKIEAFV GSKTVIQIRS HAQKYFLKVQ KNGTSEHVPP  120
PRPKRKATHP YPQKAPKITP TVSQVMGPLQ PSSAFIEPAY IYSPDSSSVL GTPLTNMPLS  180
SWNYNAKPPV NVPQVTRDNM GLTGAAQTVP LNCCYSSSNE NTPPTWSSSK KNHQGGQGKP  240
IKVMPDFAQV YSFLGSVFDP NSTNNRQKLR QMDPINVETV LLLMRNLSVN LMSPEFEDHK  300
KLLSSYDIDS DESKLDNICS KSLTDKSESA IMSA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135127.10.0hypothetical protein PHAVU_010G103200g
SwissprotC0SVG51e-109RVE5_ARATH; Protein REVEILLE 5
TrEMBLV7ASD90.0V7ASD9_PHAVU; Uncharacterized protein
STRINGGLYMA16G03640.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.11e-111MYB_related family protein